GCA_008679525.1 - 5 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

gnlProkkaLCOCNJEC_5 (original name was: gnl|Prokka|LCOCNJEC_5)

Region	Type	From	To	Most similar known cluster		Similarity
Region 5.1	cyclic-lactone-autoinducer	235,466	256,199
Region 5.2	NRPS,cyclic-lactone-autoinducer	295,303	343,063	equibactin	NRP	21%

gnlProkkaLCOCNJEC_10 (original name was: gnl|Prokka|LCOCNJEC_10)

Region	Type	From	To	Most similar known cluster		Similarity
Region 10.1	NRPS	87,112	136,096	dipeptide aldehydes	NRP	88%

gnlProkkaLCOCNJEC_14 (original name was: gnl|Prokka|LCOCNJEC_14)

Region	Type	From	To	Most similar known cluster		Similarity
Region 14.1	ranthipeptide	121,898	143,486

gnlProkkaLCOCNJEC_20 (original name was: gnl|Prokka|LCOCNJEC_20)

Region	Type	From	To	Most similar known cluster		Similarity
Region 20.1	lanthipeptide-class-ii	549,866	572,547

Region	Type	From	To	Most similar known cluster	Similarity
Region 5.1	cyclic-lactone-autoinducer	235,466	256,199
Region 5.2	NRPS,cyclic-lactone-autoinducer	295,303	343,063	equibactin	NRP	21%
Region 10.1	NRPS	87,112	136,096	dipeptide aldehydes	NRP	88%
Region 14.1	ranthipeptide	121,898	143,486
Region 20.1	lanthipeptide-class-ii	549,866	572,547

Compact view

gnlProkkaLCOCNJEC_5 - Region 1 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 235,466 - 256,199 nt. (total: 20,734 nt) Show pHMM detection rules used

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

KnownClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Similar known gene clusters from MIBiG 3.1

No matches found.

gnlProkkaLCOCNJEC_5 - Region 2 - NRPS,cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 295,303 - 343,063 nt. (total: 47,761 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))
cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

NRPS/PKS domains

KnownClusterBlast

NRPS/PKS modules

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters from MIBiG 3.1

Module view

Legend

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 2, location 295302 - 343063:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Cys - Cys) + (Cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg5_260

Search NORINE for peptide: strict or relaxed

AMP-binding (25..431): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: PLPAQGVLSK
Nearest Stachelhaus code(s):: diOH-Bz PLPAQGVLCK (79% 8Å match); Sal PLPAQGVLNK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

ctg5_261

Search NORINE for peptide: strict or relaxed

AMP-binding (553..948): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNMSMIWK
Nearest Stachelhaus code(s):: Cys DLYNMSMIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1974..2374): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNMSLIWK
Nearest Stachelhaus code(s):: Cys DLYNMSLIWK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg5_263

Search NORINE for peptide: strict or relaxed

AMP-binding (507..899): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNLSLIWK
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

gnlProkkaLCOCNJEC_10 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 87,112 - 136,096 nt. (total: 48,985 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

NRPS/PKS domains

KnownClusterBlast

NRPS/PKS modules

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters from MIBiG 3.1

Module view

Legend

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 87111 - 136096:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg10_116

AMP-binding (20..419): X

nrpys: Leu, Trp

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVLTDGGISK
Nearest Stachelhaus code(s):: Leu or Trp DVLTDGGISK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1033..1421): X

nrpys: Leu, Trp

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAMFSGAIFK
Nearest Stachelhaus code(s):: Leu or Trp DAMFSGAIFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2027..2418): X

nrpys: Leu, Trp

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAITTGGVSK
Nearest Stachelhaus code(s):: Leu or Trp DAITTGGVSK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

gnlProkkaLCOCNJEC_14 - Region 1 - ranthipeptide

Download region GenBank file

Download region SVG

Location: 121,898 - 143,486 nt. (total: 21,589 nt) Show pHMM detection rules used

ranthipeptide: (TIGR03973 or SCIFF or (cds(PF04055 and (TIGR04085 or SPASM)) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]) and not (TIGR01716 or subtilosin or TIGR02111 or TIGR03966 or TIGR04103 or (YcaO or TIGR03604))))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

KnownClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Similar known gene clusters from MIBiG 3.1

No matches found.

gnlProkkaLCOCNJEC_20 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 549,866 - 572,547 nt. (total: 22,682 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

KnownClusterBlast

Lanthipeptides

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Similar known gene clusters from MIBiG 3.1

No matches found.

Lanthipeptide predictions

Lanthipeptide(s) for ctg20_477

ctg20_476

Leader:

MTEEFIGCIEEELKEIELFYEENGVEVEAYTLHNG

Core:

SFFSICC

Core with dehydrations:

DhaFFDhaICysCys

antiSMASH-DB 4.0 matches for ctg20_476

100.0% NZ_JADPAT010000014.1and 2 others:

NZ_JAQDKC010000001.1 Lanthipeptides: PGQ53_RS00010_lanthipeptideNZ_QUIY01000001.1 Lanthipeptides: allorf_008439_008567_lanthipeptide

Lanthipeptides: allorf_07424_07552_lanthipeptide

1

SFFSICC

7

SFFSICC

1

SFFSICC

7

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg20_476 - Class II: Cleavage pHMM score: -6.60; RODEO score: 0; Monoisotopic mass: 769.3 Da; Molecular weight: 769.9 Da; Number of bridges: 2