GCA_013304405.1 - 3 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

gnlProkkaJJBMFBIC_49 (original name was: gnl|Prokka|JJBMFBIC_49)

Region	Type	From	To	Most similar known cluster		Similarity
Region 15.1	lanthipeptide-class-ii	1	21,334

gnlProkkaJJBMFBIC_60 (original name was: gnl|Prokka|JJBMFBIC_60)

Region	Type	From	To	Most similar known cluster		Similarity
Region 17.1	ranthipeptide	29,318	50,906

gnlProkkaJJBMFBIC_68 (original name was: gnl|Prokka|JJBMFBIC_68)

Region	Type	From	To	Most similar known cluster		Similarity
Region 25.1	NRPS	1	34,951	dipeptide aldehydes	NRP	47%

Region	Type	From	To	Most similar known cluster	Similarity
Region 15.1	lanthipeptide-class-ii	1	21,334
Region 17.1	ranthipeptide	29,318	50,906
Region 25.1	NRPS	1	34,951	dipeptide aldehydes	NRP	47%

Compact view

gnlProkkaJJBMFBIC_49 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 1 - 21,334 nt. (total: 21,334 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

KnownClusterBlast

Lanthipeptides

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Similar known gene clusters from MIBiG 3.1

No matches found.

Lanthipeptide predictions

Lanthipeptide(s) for ctg15_9

ctg15_8

Leader:

MNEMNDKIIGNVEKELDEIEIIDTESIEEKLSFIVYG

Core:

TIVCC

Core with dehydrations:

DhbIVCysCys

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg15_8 - Class II: Cleavage pHMM score: -5.90; RODEO score: 0; Monoisotopic mass: 519.2 Da; Molecular weight: 519.7 Da; Number of bridges: 1

gnlProkkaJJBMFBIC_60 - Region 1 - ranthipeptide

Download region GenBank file

Download region SVG

Location: 29,318 - 50,906 nt. (total: 21,589 nt) Show pHMM detection rules used

ranthipeptide: (TIGR03973 or SCIFF or (cds(PF04055 and (TIGR04085 or SPASM)) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]) and not (TIGR01716 or subtilosin or TIGR02111 or TIGR03966 or TIGR04103 or (YcaO or TIGR03604))))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

KnownClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Similar known gene clusters from MIBiG 3.1

No matches found.

gnlProkkaJJBMFBIC_68 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 34,951 nt. (total: 34,951 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

NRPS/PKS domains

KnownClusterBlast

NRPS/PKS modules

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters from MIBiG 3.1

Module view

Legend

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 34951:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg25_7

AMP-binding (20..419): X

nrpys: Leu, Trp

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVLTDGGISK
Nearest Stachelhaus code(s):: Leu or Trp DVLTDGGISK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1033..1421): X

nrpys: Leu, Trp

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAMFSGAIFK
Nearest Stachelhaus code(s):: Leu or Trp DAMFSGAIFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2027..2418): X

nrpys: Leu, Trp

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAITTGGVSK
Nearest Stachelhaus code(s):: Leu or Trp DAITTGGVSK (100% 8Å match)
Stachelhaus code match:: 100% (strong)