GCA_015554555.1 - 5 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

gnlProkkaDLLMBJLK_13 (original name was: gnl|Prokka|DLLMBJLK_13)

Region	Type	From	To	Most similar known cluster		Similarity
Region 13.1	ranthipeptide	232	21,820

gnlProkkaDLLMBJLK_17 (original name was: gnl|Prokka|DLLMBJLK_17)

Region	Type	From	To	Most similar known cluster		Similarity
Region 17.1	lanthipeptide-class-ii	1	22,189

gnlProkkaDLLMBJLK_24 (original name was: gnl|Prokka|DLLMBJLK_24)

Region	Type	From	To	Most similar known cluster		Similarity
Region 24.1	NRPS	20,388	55,772	dipeptide aldehydes	NRP	47%

gnlProkkaDLLMBJLK_33 (original name was: gnl|Prokka|DLLMBJLK_33)

Region	Type	From	To	Most similar known cluster		Similarity
Region 33.1	ranthipeptide	1	37,097

gnlProkkaDLLMBJLK_98 (original name was: gnl|Prokka|DLLMBJLK_98)

Region	Type	From	To	Most similar known cluster		Similarity
Region 98.1	NRPS,cyclic-lactone-autoinducer	1	47,125

Region	Type	From	To	Most similar known cluster	Similarity
Region 13.1	ranthipeptide	232	21,820
Region 17.1	lanthipeptide-class-ii	1	22,189
Region 24.1	NRPS	20,388	55,772	dipeptide aldehydes	NRP	47%
Region 33.1	ranthipeptide	1	37,097
Region 98.1	NRPS,cyclic-lactone-autoinducer	1	47,125

Compact view

gnlProkkaDLLMBJLK_13 - Region 1 - ranthipeptide

Download region GenBank file

Download region SVG

Location: 232 - 21,820 nt. (total: 21,589 nt) Show pHMM detection rules used

Region on contig edge.

ranthipeptide: (TIGR03973 or SCIFF or (cds(PF04055 and (TIGR04085 or SPASM)) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]) and not (TIGR01716 or subtilosin or TIGR02111 or TIGR03966 or TIGR04103 or (YcaO or TIGR03604))))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

KnownClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Similar known gene clusters from MIBiG 3.1

No matches found.

gnlProkkaDLLMBJLK_17 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 1 - 22,189 nt. (total: 22,189 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

KnownClusterBlast

Lanthipeptides

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Similar known gene clusters from MIBiG 3.1

No matches found.

Lanthipeptide predictions

Lanthipeptide(s) for ctg17_10

ctg17_9

Leader:

MNEMNDKIIGNVEKELDEIEIIDTESIEEKLSFIVYG

Core:

TIVCC

Core with dehydrations:

DhbIVCysCys

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg17_9 - Class II: Cleavage pHMM score: -5.90; RODEO score: 0; Monoisotopic mass: 519.2 Da; Molecular weight: 519.7 Da; Number of bridges: 1

gnlProkkaDLLMBJLK_24 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 20,388 - 55,772 nt. (total: 35,385 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

NRPS/PKS domains

KnownClusterBlast

NRPS/PKS modules

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters from MIBiG 3.1

Module view

Legend

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 20387 - 55772:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg24_45

AMP-binding (20..419): X

nrpys: Leu, Trp

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVLTDGGISK
Nearest Stachelhaus code(s):: Leu or Trp DVLTDGGISK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1033..1421): X

nrpys: Leu, Trp

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAMFSGAIFK
Nearest Stachelhaus code(s):: Leu or Trp DAMFSGAIFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2027..2418): X

nrpys: Leu, Trp

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAITTGGVSK
Nearest Stachelhaus code(s):: Leu or Trp DAITTGGVSK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

gnlProkkaDLLMBJLK_33 - Region 1 - ranthipeptide

Download region GenBank file

Download region SVG

Location: 1 - 37,097 nt. (total: 37,097 nt) Show pHMM detection rules used

Region on contig edge.

ranthipeptide: (TIGR03973 or SCIFF or (cds(PF04055 and (TIGR04085 or SPASM)) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]) and not (TIGR01716 or subtilosin or TIGR02111 or TIGR03966 or TIGR04103 or (YcaO or TIGR03604))))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

KnownClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Similar known gene clusters from MIBiG 3.1

No matches found.

gnlProkkaDLLMBJLK_98 - Region 1 - NRPS,cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 1 - 47,125 nt. (total: 47,125 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))
cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

NRPS/PKS domains

KnownClusterBlast

NRPS/PKS modules

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters from MIBiG 3.1

No matches found.

Module view

Legend

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 47125:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Cys - Cys - Cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg98_19

Search NORINE for peptide: strict or relaxed

AMP-binding (548..941): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNLSLIWK
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1594..1991): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNLSLIWK
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2704..3085): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNLSLIWK
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg98_20

AMP-binding (25..444): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VALMFGVTAK
Nearest Stachelhaus code(s):: aIle DALVFGVVLK (32% 8Å match)
Stachelhaus code match:: 60% (weak)