GCA_028307195.1 - 5 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

gnlProkkaPBDJBLMN_2 (original name was: gnl|Prokka|PBDJBLMN_2)

Region	Type	From	To	Most similar known cluster		Similarity
Region 2.1	ranthipeptide	1	16,096

gnlProkkaPBDJBLMN_34 (original name was: gnl|Prokka|PBDJBLMN_34)

Region	Type	From	To	Most similar known cluster		Similarity
Region 34.1	cyclic-lactone-autoinducer	1	15,527

gnlProkkaPBDJBLMN_35 (original name was: gnl|Prokka|PBDJBLMN_35)

Region	Type	From	To	Most similar known cluster		Similarity
Region 35.1	NRPS	1	30,953	dipeptide aldehydes	NRP	23%

gnlProkkaPBDJBLMN_45 (original name was: gnl|Prokka|PBDJBLMN_45)

Region	Type	From	To	Most similar known cluster		Similarity
Region 45.1	RiPP-like	10,085	19,799

gnlProkkaPBDJBLMN_66 (original name was: gnl|Prokka|PBDJBLMN_66)

Region	Type	From	To	Most similar known cluster		Similarity
Region 66.1	lanthipeptide-class-ii	1	22,373

Region	Type	From	To	Most similar known cluster	Similarity
Region 2.1	ranthipeptide	1	16,096
Region 34.1	cyclic-lactone-autoinducer	1	15,527
Region 35.1	NRPS	1	30,953	dipeptide aldehydes	NRP	23%
Region 45.1	RiPP-like	10,085	19,799
Region 66.1	lanthipeptide-class-ii	1	22,373

No secondary metabolite regions were found in these records:: gnlProkkaPBDJBLMN_1 (original name was: gnl|Prokka|PBDJBLMN_1); gnlProkkaPBDJBLMN_3 (original name was: gnl|Prokka|PBDJBLMN_3); gnlProkkaPBDJBLMN_4 (original name was: gnl|Prokka|PBDJBLMN_4); gnlProkkaPBDJBLMN_5 (original name was: gnl|Prokka|PBDJBLMN_5); gnlProkkaPBDJBLMN_6 (original name was: gnl|Prokka|PBDJBLMN_6); gnlProkkaPBDJBLMN_7 (original name was: gnl|Prokka|PBDJBLMN_7); gnlProkkaPBDJBLMN_8 (original name was: gnl|Prokka|PBDJBLMN_8); gnlProkkaPBDJBLMN_9 (original name was: gnl|Prokka|PBDJBLMN_9); gnlProkkaPBDJBLMN_10 (original name was: gnl|Prokka|PBDJBLMN_10); gnlProkkaPBDJBLMN_11 (original name was: gnl|Prokka|PBDJBLMN_11); gnlProkkaPBDJBLMN_12 (original name was: gnl|Prokka|PBDJBLMN_12); gnlProkkaPBDJBLMN_13 (original name was: gnl|Prokka|PBDJBLMN_13); gnlProkkaPBDJBLMN_14 (original name was: gnl|Prokka|PBDJBLMN_14); gnlProkkaPBDJBLMN_15 (original name was: gnl|Prokka|PBDJBLMN_15); gnlProkkaPBDJBLMN_16 (original name was: gnl|Prokka|PBDJBLMN_16); gnlProkkaPBDJBLMN_17 (original name was: gnl|Prokka|PBDJBLMN_17); gnlProkkaPBDJBLMN_18 (original name was: gnl|Prokka|PBDJBLMN_18); gnlProkkaPBDJBLMN_19 (original name was: gnl|Prokka|PBDJBLMN_19); gnlProkkaPBDJBLMN_20 (original name was: gnl|Prokka|PBDJBLMN_20); gnlProkkaPBDJBLMN_21 (original name was: gnl|Prokka|PBDJBLMN_21); gnlProkkaPBDJBLMN_22 (original name was: gnl|Prokka|PBDJBLMN_22); gnlProkkaPBDJBLMN_23 (original name was: gnl|Prokka|PBDJBLMN_23); gnlProkkaPBDJBLMN_24 (original name was: gnl|Prokka|PBDJBLMN_24); gnlProkkaPBDJBLMN_25 (original name was: gnl|Prokka|PBDJBLMN_25); gnlProkkaPBDJBLMN_26 (original name was: gnl|Prokka|PBDJBLMN_26); gnlProkkaPBDJBLMN_27 (original name was: gnl|Prokka|PBDJBLMN_27); gnlProkkaPBDJBLMN_28 (original name was: gnl|Prokka|PBDJBLMN_28); gnlProkkaPBDJBLMN_29 (original name was: gnl|Prokka|PBDJBLMN_29); gnlProkkaPBDJBLMN_30 (original name was: gnl|Prokka|PBDJBLMN_30); gnlProkkaPBDJBLMN_31 (original name was: gnl|Prokka|PBDJBLMN_31); gnlProkkaPBDJBLMN_32 (original name was: gnl|Prokka|PBDJBLMN_32); gnlProkkaPBDJBLMN_33 (original name was: gnl|Prokka|PBDJBLMN_33); gnlProkkaPBDJBLMN_36 (original name was: gnl|Prokka|PBDJBLMN_36); gnlProkkaPBDJBLMN_37 (original name was: gnl|Prokka|PBDJBLMN_37); gnlProkkaPBDJBLMN_38 (original name was: gnl|Prokka|PBDJBLMN_38); gnlProkkaPBDJBLMN_39 (original name was: gnl|Prokka|PBDJBLMN_39); gnlProkkaPBDJBLMN_40 (original name was: gnl|Prokka|PBDJBLMN_40); gnlProkkaPBDJBLMN_41 (original name was: gnl|Prokka|PBDJBLMN_41); gnlProkkaPBDJBLMN_42 (original name was: gnl|Prokka|PBDJBLMN_42); gnlProkkaPBDJBLMN_43 (original name was: gnl|Prokka|PBDJBLMN_43); gnlProkkaPBDJBLMN_44 (original name was: gnl|Prokka|PBDJBLMN_44); gnlProkkaPBDJBLMN_46 (original name was: gnl|Prokka|PBDJBLMN_46); gnlProkkaPBDJBLMN_47 (original name was: gnl|Prokka|PBDJBLMN_47); gnlProkkaPBDJBLMN_48 (original name was: gnl|Prokka|PBDJBLMN_48); gnlProkkaPBDJBLMN_49 (original name was: gnl|Prokka|PBDJBLMN_49); gnlProkkaPBDJBLMN_50 (original name was: gnl|Prokka|PBDJBLMN_50); gnlProkkaPBDJBLMN_51 (original name was: gnl|Prokka|PBDJBLMN_51); gnlProkkaPBDJBLMN_52 (original name was: gnl|Prokka|PBDJBLMN_52); gnlProkkaPBDJBLMN_53 (original name was: gnl|Prokka|PBDJBLMN_53); gnlProkkaPBDJBLMN_54 (original name was: gnl|Prokka|PBDJBLMN_54); gnlProkkaPBDJBLMN_55 (original name was: gnl|Prokka|PBDJBLMN_55); gnlProkkaPBDJBLMN_56 (original name was: gnl|Prokka|PBDJBLMN_56); gnlProkkaPBDJBLMN_57 (original name was: gnl|Prokka|PBDJBLMN_57); gnlProkkaPBDJBLMN_58 (original name was: gnl|Prokka|PBDJBLMN_58); gnlProkkaPBDJBLMN_59 (original name was: gnl|Prokka|PBDJBLMN_59); gnlProkkaPBDJBLMN_60 (original name was: gnl|Prokka|PBDJBLMN_60); gnlProkkaPBDJBLMN_61 (original name was: gnl|Prokka|PBDJBLMN_61); gnlProkkaPBDJBLMN_62 (original name was: gnl|Prokka|PBDJBLMN_62); gnlProkkaPBDJBLMN_63 (original name was: gnl|Prokka|PBDJBLMN_63); gnlProkkaPBDJBLMN_64 (original name was: gnl|Prokka|PBDJBLMN_64); gnlProkkaPBDJBLMN_65 (original name was: gnl|Prokka|PBDJBLMN_65); gnlProkkaPBDJBLMN_67 (original name was: gnl|Prokka|PBDJBLMN_67); gnlProkkaPBDJBLMN_68 (original name was: gnl|Prokka|PBDJBLMN_68); gnlProkkaPBDJBLMN_69 (original name was: gnl|Prokka|PBDJBLMN_69); gnlProkkaPBDJBLMN_70 (original name was: gnl|Prokka|PBDJBLMN_70); gnlProkkaPBDJBLMN_71 (original name was: gnl|Prokka|PBDJBLMN_71); gnlProkkaPBDJBLMN_72 (original name was: gnl|Prokka|PBDJBLMN_72); gnlProkkaPBDJBLMN_73 (original name was: gnl|Prokka|PBDJBLMN_73); gnlProkkaPBDJBLMN_74 (original name was: gnl|Prokka|PBDJBLMN_74); gnlProkkaPBDJBLMN_75 (original name was: gnl|Prokka|PBDJBLMN_75); gnlProkkaPBDJBLMN_76 (original name was: gnl|Prokka|PBDJBLMN_76); gnlProkkaPBDJBLMN_77 (original name was: gnl|Prokka|PBDJBLMN_77); gnlProkkaPBDJBLMN_78 (original name was: gnl|Prokka|PBDJBLMN_78); gnlProkkaPBDJBLMN_79 (original name was: gnl|Prokka|PBDJBLMN_79); gnlProkkaPBDJBLMN_80 (original name was: gnl|Prokka|PBDJBLMN_80); gnlProkkaPBDJBLMN_81 (original name was: gnl|Prokka|PBDJBLMN_81); gnlProkkaPBDJBLMN_82 (original name was: gnl|Prokka|PBDJBLMN_82); gnlProkkaPBDJBLMN_83 (original name was: gnl|Prokka|PBDJBLMN_83); gnlProkkaPBDJBLMN_84 (original name was: gnl|Prokka|PBDJBLMN_84)

Compact view

gnlProkkaPBDJBLMN_2 - Region 1 - ranthipeptide

Download region GenBank file

Download region SVG

Location: 1 - 16,096 nt. (total: 16,096 nt) Show pHMM detection rules used

Region on contig edge.

ranthipeptide: (TIGR03973 or SCIFF or (cds(PF04055 and (TIGR04085 or SPASM)) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]) and not (TIGR01716 or subtilosin or TIGR02111 or TIGR03966 or TIGR04103 or (YcaO or TIGR03604))))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

KnownClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Similar known gene clusters from MIBiG 3.1

No matches found.

gnlProkkaPBDJBLMN_34 - Region 1 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 1 - 15,527 nt. (total: 15,527 nt) Show pHMM detection rules used

Region on contig edge.

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

KnownClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Similar known gene clusters from MIBiG 3.1

No matches found.

gnlProkkaPBDJBLMN_35 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 30,953 nt. (total: 30,953 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

NRPS/PKS domains

KnownClusterBlast

NRPS/PKS modules

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters from MIBiG 3.1

Module view

Legend

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 30953:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg35_3

AMP-binding (22..421): X

nrpys: Leu, Trp

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVLTDGGISK
Nearest Stachelhaus code(s):: Leu or Trp DVLTDGGISK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1035..1423): X

nrpys: Leu, Trp

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAMFSGAIFK
Nearest Stachelhaus code(s):: Leu or Trp DAMFSGAIFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2029..2420): X

nrpys: Leu, Trp

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAITTGGVSK
Nearest Stachelhaus code(s):: Leu or Trp DAITTGGVSK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

gnlProkkaPBDJBLMN_45 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 10,085 - 19,799 nt. (total: 9,715 nt) Show pHMM detection rules used

Region on contig edge.

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

KnownClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Similar known gene clusters from MIBiG 3.1

No matches found.

gnlProkkaPBDJBLMN_66 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 1 - 22,373 nt. (total: 22,373 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

KnownClusterBlast

Lanthipeptides

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Similar known gene clusters from MIBiG 3.1

No matches found.

Lanthipeptide predictions

Lanthipeptide(s) for ctg66_10

ctg66_9

Leader:

MNEMNDKIIGNVEKELDEIEIIDTESIEEKLSFIVYG

Core:

TIVCC

Core with dehydrations:

DhbIVCysCys

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg66_9 - Class II: Cleavage pHMM score: -5.90; RODEO score: 0; Monoisotopic mass: 519.2 Da; Molecular weight: 519.7 Da; Number of bridges: 1