GCA_028309965.1 - 8 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

gnlProkkaKOFLAKMA_29 (original name was: gnl|Prokka|KOFLAKMA_29)

Region	Type	From	To	Most similar known cluster		Similarity
Region 29.1	RRE-containing	1	9,540

gnlProkkaKOFLAKMA_55 (original name was: gnl|Prokka|KOFLAKMA_55)

Region	Type	From	To	Most similar known cluster		Similarity
Region 55.1	cyclic-lactone-autoinducer	1	10,758

gnlProkkaKOFLAKMA_83 (original name was: gnl|Prokka|KOFLAKMA_83)

Region	Type	From	To	Most similar known cluster		Similarity
Region 83.1	lanthipeptide-class-ii	1	4,888

gnlProkkaKOFLAKMA_84 (original name was: gnl|Prokka|KOFLAKMA_84)

Region	Type	From	To	Most similar known cluster		Similarity
Region 84.1	RRE-containing	1	4,857

gnlProkkaKOFLAKMA_96 (original name was: gnl|Prokka|KOFLAKMA_96)

Region	Type	From	To	Most similar known cluster		Similarity
Region 96.1	lanthipeptide-class-ii	1	3,955

gnlProkkaKOFLAKMA_188 (original name was: gnl|Prokka|KOFLAKMA_188)

Region	Type	From	To	Most similar known cluster		Similarity
Region 188.1	NRPS	1	35,020	dipeptide aldehydes	NRP	41%

gnlProkkaKOFLAKMA_193 (original name was: gnl|Prokka|KOFLAKMA_193)

Region	Type	From	To	Most similar known cluster		Similarity
Region 193.1	ranthipeptide	1	13,686

gnlProkkaKOFLAKMA_197 (original name was: gnl|Prokka|KOFLAKMA_197)

Region	Type	From	To	Most similar known cluster		Similarity
Region 197.1	NRPS-like,NRPS	1	31,062	ulbactin F/ulbactin G	NRP	28%

Region	Type	From	To	Most similar known cluster	Similarity
Region 29.1	RRE-containing	1	9,540
Region 55.1	cyclic-lactone-autoinducer	1	10,758
Region 83.1	lanthipeptide-class-ii	1	4,888
Region 84.1	RRE-containing	1	4,857
Region 96.1	lanthipeptide-class-ii	1	3,955
Region 188.1	NRPS	1	35,020	dipeptide aldehydes	NRP	41%
Region 193.1	ranthipeptide	1	13,686
Region 197.1	NRPS-like,NRPS	1	31,062	ulbactin F/ulbactin G	NRP	28%

Compact view

gnlProkkaKOFLAKMA_29 - Region 1 - RRE-containing

Download region GenBank file

Download region SVG

Location: 1 - 9,540 nt. (total: 9,540 nt) Show pHMM detection rules used

Region on contig edge.

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

KnownClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Similar known gene clusters from MIBiG 3.1

No matches found.

gnlProkkaKOFLAKMA_55 - Region 1 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 1 - 10,758 nt. (total: 10,758 nt) Show pHMM detection rules used

Region on contig edge.

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

KnownClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Similar known gene clusters from MIBiG 3.1

No matches found.

gnlProkkaKOFLAKMA_83 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 1 - 4,888 nt. (total: 4,888 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

KnownClusterBlast

Lanthipeptides

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Similar known gene clusters from MIBiG 3.1

No matches found.

Lanthipeptide predictions

Lanthipeptide(s) for ctg83_3

ctg83_2

Leader:

MNEMNDKIIGNVEKELDEIEIIDTESIEEKLSFIVYG

Core:

TIVCC

Core with dehydrations:

DhbIVCysCys

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg83_2 - Class II: Cleavage pHMM score: -5.90; RODEO score: 0; Monoisotopic mass: 519.2 Da; Molecular weight: 519.7 Da; Number of bridges: 1

gnlProkkaKOFLAKMA_84 - Region 1 - RRE-containing

Download region GenBank file

Download region SVG

Location: 1 - 4,857 nt. (total: 4,857 nt) Show pHMM detection rules used

Region on contig edge.

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

KnownClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Similar known gene clusters from MIBiG 3.1

No matches found.

gnlProkkaKOFLAKMA_96 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 1 - 3,955 nt. (total: 3,955 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

KnownClusterBlast

Lanthipeptides

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Similar known gene clusters from MIBiG 3.1

No matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

gnlProkkaKOFLAKMA_188 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 35,020 nt. (total: 35,020 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

NRPS/PKS domains

KnownClusterBlast

NRPS/PKS modules

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters from MIBiG 3.1

Module view

Legend

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 35020:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg188_6

AMP-binding (22..421): X

nrpys: Leu, Trp

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVLTDGGISK
Nearest Stachelhaus code(s):: Leu or Trp DVLTDGGISK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1035..1423): X

nrpys: Leu, Trp

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAMFSGAIFK
Nearest Stachelhaus code(s):: Leu or Trp DAMFSGAIFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2029..2420): X

nrpys: Leu, Trp

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAITTGGVSK
Nearest Stachelhaus code(s):: Leu or Trp DAITTGGVSK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

gnlProkkaKOFLAKMA_193 - Region 1 - ranthipeptide

Download region GenBank file

Download region SVG

Location: 1 - 13,686 nt. (total: 13,686 nt) Show pHMM detection rules used

Region on contig edge.

ranthipeptide: (TIGR03973 or SCIFF or (cds(PF04055 and (TIGR04085 or SPASM)) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]) and not (TIGR01716 or subtilosin or TIGR02111 or TIGR03966 or TIGR04103 or (YcaO or TIGR03604))))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

KnownClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Similar known gene clusters from MIBiG 3.1

No matches found.

gnlProkkaKOFLAKMA_197 - Region 1 - NRPS,NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 31,062 nt. (total: 31,062 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

NRPS/PKS domains

KnownClusterBlast

NRPS/PKS modules

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters from MIBiG 3.1

Module view

Legend

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 31062:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Cys - Cys) + (Cys)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 281 - 31062:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Cys - Cys) + (Cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg197_20

Search NORINE for peptide: strict or relaxed

AMP-binding (20..397): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNLSLIWK
Nearest Stachelhaus code(s):: Cys DLFNLSLIWK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg197_23

Search NORINE for peptide: strict or relaxed

AMP-binding (367..762): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNMSMIWK
Nearest Stachelhaus code(s):: Cys DLYNMSMIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1788..2188): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNMSLIWK
Nearest Stachelhaus code(s):: Cys DLYNMSLIWK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg197_25

Search NORINE for peptide: strict or relaxed

AMP-binding (39..445): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: PLPAQGVLSK
Nearest Stachelhaus code(s):: diOH-Bz PLPAQGVLCK (79% 8Å match); Sal PLPAQGVLNK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)