GCA_959605195.1 - 7 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

gnlProkkaBNBIDJCA_3 (original name was: gnl|Prokka|BNBIDJCA_3)

Region	Type	From	To	Most similar known cluster		Similarity
Region 3.1	NRPS,cyclic-lactone-autoinducer	25,352	81,033	ulbactin F/ulbactin G	NRP	28%

gnlProkkaBNBIDJCA_5 (original name was: gnl|Prokka|BNBIDJCA_5)

Region	Type	From	To	Most similar known cluster		Similarity
Region 5.1	lanthipeptide-class-ii	23,775	46,456

gnlProkkaBNBIDJCA_17 (original name was: gnl|Prokka|BNBIDJCA_17)

Region	Type	From	To	Most similar known cluster		Similarity
Region 17.1	RRE-containing	16,861	38,408

gnlProkkaBNBIDJCA_22 (original name was: gnl|Prokka|BNBIDJCA_22)

Region	Type	From	To	Most similar known cluster		Similarity
Region 22.1	ranthipeptide	32,190	51,266

gnlProkkaBNBIDJCA_29 (original name was: gnl|Prokka|BNBIDJCA_29)

Region	Type	From	To	Most similar known cluster		Similarity
Region 29.1	NRPS	1	36,206	dipeptide aldehydes	NRP	52%

gnlProkkaBNBIDJCA_31 (original name was: gnl|Prokka|BNBIDJCA_31)

Region	Type	From	To	Most similar known cluster		Similarity
Region 31.1	cyclic-lactone-autoinducer	20,981	39,673

gnlProkkaBNBIDJCA_47 (original name was: gnl|Prokka|BNBIDJCA_47)

Region	Type	From	To	Most similar known cluster		Similarity
Region 47.1	ranthipeptide	9,701	28,182

No secondary metabolite regions were found in these records:: gnlProkkaBNBIDJCA_1 (original name was: gnl|Prokka|BNBIDJCA_1); gnlProkkaBNBIDJCA_2 (original name was: gnl|Prokka|BNBIDJCA_2); gnlProkkaBNBIDJCA_4 (original name was: gnl|Prokka|BNBIDJCA_4); gnlProkkaBNBIDJCA_6 (original name was: gnl|Prokka|BNBIDJCA_6); gnlProkkaBNBIDJCA_7 (original name was: gnl|Prokka|BNBIDJCA_7); gnlProkkaBNBIDJCA_8 (original name was: gnl|Prokka|BNBIDJCA_8); gnlProkkaBNBIDJCA_9 (original name was: gnl|Prokka|BNBIDJCA_9); gnlProkkaBNBIDJCA_10 (original name was: gnl|Prokka|BNBIDJCA_10); gnlProkkaBNBIDJCA_11 (original name was: gnl|Prokka|BNBIDJCA_11); gnlProkkaBNBIDJCA_12 (original name was: gnl|Prokka|BNBIDJCA_12); gnlProkkaBNBIDJCA_13 (original name was: gnl|Prokka|BNBIDJCA_13); gnlProkkaBNBIDJCA_14 (original name was: gnl|Prokka|BNBIDJCA_14); gnlProkkaBNBIDJCA_15 (original name was: gnl|Prokka|BNBIDJCA_15); gnlProkkaBNBIDJCA_16 (original name was: gnl|Prokka|BNBIDJCA_16); gnlProkkaBNBIDJCA_18 (original name was: gnl|Prokka|BNBIDJCA_18); gnlProkkaBNBIDJCA_19 (original name was: gnl|Prokka|BNBIDJCA_19); gnlProkkaBNBIDJCA_20 (original name was: gnl|Prokka|BNBIDJCA_20); gnlProkkaBNBIDJCA_21 (original name was: gnl|Prokka|BNBIDJCA_21); gnlProkkaBNBIDJCA_23 (original name was: gnl|Prokka|BNBIDJCA_23); gnlProkkaBNBIDJCA_24 (original name was: gnl|Prokka|BNBIDJCA_24); gnlProkkaBNBIDJCA_25 (original name was: gnl|Prokka|BNBIDJCA_25); gnlProkkaBNBIDJCA_26 (original name was: gnl|Prokka|BNBIDJCA_26); gnlProkkaBNBIDJCA_27 (original name was: gnl|Prokka|BNBIDJCA_27); gnlProkkaBNBIDJCA_28 (original name was: gnl|Prokka|BNBIDJCA_28); gnlProkkaBNBIDJCA_30 (original name was: gnl|Prokka|BNBIDJCA_30); gnlProkkaBNBIDJCA_32 (original name was: gnl|Prokka|BNBIDJCA_32); gnlProkkaBNBIDJCA_33 (original name was: gnl|Prokka|BNBIDJCA_33); gnlProkkaBNBIDJCA_34 (original name was: gnl|Prokka|BNBIDJCA_34); gnlProkkaBNBIDJCA_35 (original name was: gnl|Prokka|BNBIDJCA_35); gnlProkkaBNBIDJCA_36 (original name was: gnl|Prokka|BNBIDJCA_36); gnlProkkaBNBIDJCA_37 (original name was: gnl|Prokka|BNBIDJCA_37); gnlProkkaBNBIDJCA_38 (original name was: gnl|Prokka|BNBIDJCA_38); gnlProkkaBNBIDJCA_39 (original name was: gnl|Prokka|BNBIDJCA_39); gnlProkkaBNBIDJCA_40 (original name was: gnl|Prokka|BNBIDJCA_40); gnlProkkaBNBIDJCA_41 (original name was: gnl|Prokka|BNBIDJCA_41); gnlProkkaBNBIDJCA_42 (original name was: gnl|Prokka|BNBIDJCA_42); gnlProkkaBNBIDJCA_43 (original name was: gnl|Prokka|BNBIDJCA_43); gnlProkkaBNBIDJCA_44 (original name was: gnl|Prokka|BNBIDJCA_44); gnlProkkaBNBIDJCA_45 (original name was: gnl|Prokka|BNBIDJCA_45); gnlProkkaBNBIDJCA_46 (original name was: gnl|Prokka|BNBIDJCA_46); gnlProkkaBNBIDJCA_48 (original name was: gnl|Prokka|BNBIDJCA_48); gnlProkkaBNBIDJCA_49 (original name was: gnl|Prokka|BNBIDJCA_49); gnlProkkaBNBIDJCA_50 (original name was: gnl|Prokka|BNBIDJCA_50); gnlProkkaBNBIDJCA_51 (original name was: gnl|Prokka|BNBIDJCA_51); gnlProkkaBNBIDJCA_52 (original name was: gnl|Prokka|BNBIDJCA_52); gnlProkkaBNBIDJCA_53 (original name was: gnl|Prokka|BNBIDJCA_53); gnlProkkaBNBIDJCA_54 (original name was: gnl|Prokka|BNBIDJCA_54); gnlProkkaBNBIDJCA_55 (original name was: gnl|Prokka|BNBIDJCA_55); gnlProkkaBNBIDJCA_56 (original name was: gnl|Prokka|BNBIDJCA_56); gnlProkkaBNBIDJCA_57 (original name was: gnl|Prokka|BNBIDJCA_57); gnlProkkaBNBIDJCA_58 (original name was: gnl|Prokka|BNBIDJCA_58); gnlProkkaBNBIDJCA_59 (original name was: gnl|Prokka|BNBIDJCA_59); gnlProkkaBNBIDJCA_60 (original name was: gnl|Prokka|BNBIDJCA_60); gnlProkkaBNBIDJCA_61 (original name was: gnl|Prokka|BNBIDJCA_61); gnlProkkaBNBIDJCA_62 (original name was: gnl|Prokka|BNBIDJCA_62); gnlProkkaBNBIDJCA_63 (original name was: gnl|Prokka|BNBIDJCA_63); gnlProkkaBNBIDJCA_64 (original name was: gnl|Prokka|BNBIDJCA_64); gnlProkkaBNBIDJCA_65 (original name was: gnl|Prokka|BNBIDJCA_65); gnlProkkaBNBIDJCA_66 (original name was: gnl|Prokka|BNBIDJCA_66); gnlProkkaBNBIDJCA_67 (original name was: gnl|Prokka|BNBIDJCA_67); gnlProkkaBNBIDJCA_68 (original name was: gnl|Prokka|BNBIDJCA_68); gnlProkkaBNBIDJCA_69 (original name was: gnl|Prokka|BNBIDJCA_69); gnlProkkaBNBIDJCA_70 (original name was: gnl|Prokka|BNBIDJCA_70); gnlProkkaBNBIDJCA_71 (original name was: gnl|Prokka|BNBIDJCA_71); gnlProkkaBNBIDJCA_72 (original name was: gnl|Prokka|BNBIDJCA_72); gnlProkkaBNBIDJCA_73 (original name was: gnl|Prokka|BNBIDJCA_73); gnlProkkaBNBIDJCA_74 (original name was: gnl|Prokka|BNBIDJCA_74); gnlProkkaBNBIDJCA_75 (original name was: gnl|Prokka|BNBIDJCA_75); gnlProkkaBNBIDJCA_76 (original name was: gnl|Prokka|BNBIDJCA_76); gnlProkkaBNBIDJCA_77 (original name was: gnl|Prokka|BNBIDJCA_77); gnlProkkaBNBIDJCA_78 (original name was: gnl|Prokka|BNBIDJCA_78); gnlProkkaBNBIDJCA_79 (original name was: gnl|Prokka|BNBIDJCA_79); gnlProkkaBNBIDJCA_80 (original name was: gnl|Prokka|BNBIDJCA_80); gnlProkkaBNBIDJCA_81 (original name was: gnl|Prokka|BNBIDJCA_81); gnlProkkaBNBIDJCA_82 (original name was: gnl|Prokka|BNBIDJCA_82); gnlProkkaBNBIDJCA_83 (original name was: gnl|Prokka|BNBIDJCA_83); gnlProkkaBNBIDJCA_84 (original name was: gnl|Prokka|BNBIDJCA_84); gnlProkkaBNBIDJCA_85 (original name was: gnl|Prokka|BNBIDJCA_85); gnlProkkaBNBIDJCA_86 (original name was: gnl|Prokka|BNBIDJCA_86); gnlProkkaBNBIDJCA_87 (original name was: gnl|Prokka|BNBIDJCA_87); gnlProkkaBNBIDJCA_88 (original name was: gnl|Prokka|BNBIDJCA_88); gnlProkkaBNBIDJCA_89 (original name was: gnl|Prokka|BNBIDJCA_89); gnlProkkaBNBIDJCA_90 (original name was: gnl|Prokka|BNBIDJCA_90); gnlProkkaBNBIDJCA_91 (original name was: gnl|Prokka|BNBIDJCA_91); gnlProkkaBNBIDJCA_92 (original name was: gnl|Prokka|BNBIDJCA_92); gnlProkkaBNBIDJCA_93 (original name was: gnl|Prokka|BNBIDJCA_93); gnlProkkaBNBIDJCA_94 (original name was: gnl|Prokka|BNBIDJCA_94); gnlProkkaBNBIDJCA_95 (original name was: gnl|Prokka|BNBIDJCA_95); gnlProkkaBNBIDJCA_96 (original name was: gnl|Prokka|BNBIDJCA_96); gnlProkkaBNBIDJCA_97 (original name was: gnl|Prokka|BNBIDJCA_97); gnlProkkaBNBIDJCA_98 (original name was: gnl|Prokka|BNBIDJCA_98); gnlProkkaBNBIDJCA_99 (original name was: gnl|Prokka|BNBIDJCA_99); gnlProkkaBNBIDJCA_100 (original name was: gnl|Prokka|BNBIDJCA_100); gnlProkkaBNBIDJCA_101 (original name was: gnl|Prokka|BNBIDJCA_101); gnlProkkaBNBIDJCA_102 (original name was: gnl|Prokka|BNBIDJCA_102); gnlProkkaBNBIDJCA_103 (original name was: gnl|Prokka|BNBIDJCA_103); gnlProkkaBNBIDJCA_104 (original name was: gnl|Prokka|BNBIDJCA_104); gnlProkkaBNBIDJCA_105 (original name was: gnl|Prokka|BNBIDJCA_105); gnlProkkaBNBIDJCA_106 (original name was: gnl|Prokka|BNBIDJCA_106); gnlProkkaBNBIDJCA_107 (original name was: gnl|Prokka|BNBIDJCA_107); gnlProkkaBNBIDJCA_108 (original name was: gnl|Prokka|BNBIDJCA_108); gnlProkkaBNBIDJCA_109 (original name was: gnl|Prokka|BNBIDJCA_109); gnlProkkaBNBIDJCA_110 (original name was: gnl|Prokka|BNBIDJCA_110); gnlProkkaBNBIDJCA_111 (original name was: gnl|Prokka|BNBIDJCA_111); gnlProkkaBNBIDJCA_112 (original name was: gnl|Prokka|BNBIDJCA_112); gnlProkkaBNBIDJCA_113 (original name was: gnl|Prokka|BNBIDJCA_113); gnlProkkaBNBIDJCA_114 (original name was: gnl|Prokka|BNBIDJCA_114); gnlProkkaBNBIDJCA_115 (original name was: gnl|Prokka|BNBIDJCA_115); gnlProkkaBNBIDJCA_116 (original name was: gnl|Prokka|BNBIDJCA_116); gnlProkkaBNBIDJCA_117 (original name was: gnl|Prokka|BNBIDJCA_117); gnlProkkaBNBIDJCA_118 (original name was: gnl|Prokka|BNBIDJCA_118); gnlProkkaBNBIDJCA_119 (original name was: gnl|Prokka|BNBIDJCA_119); gnlProkkaBNBIDJCA_120 (original name was: gnl|Prokka|BNBIDJCA_120); gnlProkkaBNBIDJCA_121 (original name was: gnl|Prokka|BNBIDJCA_121); gnlProkkaBNBIDJCA_122 (original name was: gnl|Prokka|BNBIDJCA_122); gnlProkkaBNBIDJCA_123 (original name was: gnl|Prokka|BNBIDJCA_123); gnlProkkaBNBIDJCA_124 (original name was: gnl|Prokka|BNBIDJCA_124); gnlProkkaBNBIDJCA_125 (original name was: gnl|Prokka|BNBIDJCA_125); gnlProkkaBNBIDJCA_126 (original name was: gnl|Prokka|BNBIDJCA_126); gnlProkkaBNBIDJCA_127 (original name was: gnl|Prokka|BNBIDJCA_127); gnlProkkaBNBIDJCA_128 (original name was: gnl|Prokka|BNBIDJCA_128); gnlProkkaBNBIDJCA_129 (original name was: gnl|Prokka|BNBIDJCA_129); gnlProkkaBNBIDJCA_130 (original name was: gnl|Prokka|BNBIDJCA_130); gnlProkkaBNBIDJCA_131 (original name was: gnl|Prokka|BNBIDJCA_131); gnlProkkaBNBIDJCA_132 (original name was: gnl|Prokka|BNBIDJCA_132); gnlProkkaBNBIDJCA_133 (original name was: gnl|Prokka|BNBIDJCA_133); gnlProkkaBNBIDJCA_134 (original name was: gnl|Prokka|BNBIDJCA_134); gnlProkkaBNBIDJCA_135 (original name was: gnl|Prokka|BNBIDJCA_135); gnlProkkaBNBIDJCA_136 (original name was: gnl|Prokka|BNBIDJCA_136); gnlProkkaBNBIDJCA_137 (original name was: gnl|Prokka|BNBIDJCA_137); gnlProkkaBNBIDJCA_138 (original name was: gnl|Prokka|BNBIDJCA_138); gnlProkkaBNBIDJCA_139 (original name was: gnl|Prokka|BNBIDJCA_139); gnlProkkaBNBIDJCA_140 (original name was: gnl|Prokka|BNBIDJCA_140); gnlProkkaBNBIDJCA_141 (original name was: gnl|Prokka|BNBIDJCA_141); gnlProkkaBNBIDJCA_142 (original name was: gnl|Prokka|BNBIDJCA_142); gnlProkkaBNBIDJCA_143 (original name was: gnl|Prokka|BNBIDJCA_143); gnlProkkaBNBIDJCA_144 (original name was: gnl|Prokka|BNBIDJCA_144); gnlProkkaBNBIDJCA_145 (original name was: gnl|Prokka|BNBIDJCA_145); gnlProkkaBNBIDJCA_146 (original name was: gnl|Prokka|BNBIDJCA_146); gnlProkkaBNBIDJCA_147 (original name was: gnl|Prokka|BNBIDJCA_147)

Compact view

gnlProkkaBNBIDJCA_3 - Region 1 - NRPS,cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 25,352 - 81,033 nt. (total: 55,682 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

NRPS/PKS domains

KnownClusterBlast

NRPS/PKS modules

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters from MIBiG 3.1

Module view

Legend

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 25351 - 81033:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Cys - Cys) + (Cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg3_35

Search NORINE for peptide: strict or relaxed

AMP-binding (25..431): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: PLPAQGVLSK
Nearest Stachelhaus code(s):: diOH-Bz PLPAQGVLCK (79% 8Å match); Sal PLPAQGVLNK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

ctg3_36

Search NORINE for peptide: strict or relaxed

AMP-binding (553..948): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNMSMIWK
Nearest Stachelhaus code(s):: Cys DLYNMSMIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1974..2374): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNMSLIWK
Nearest Stachelhaus code(s):: Cys DLYNMSLIWK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg3_39

Search NORINE for peptide: strict or relaxed

AMP-binding (20..397): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNLSLIWK
Nearest Stachelhaus code(s):: Cys DLFNLSLIWK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg3_40

Search NORINE for peptide: strict or relaxed

AMP-binding (537..917): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNLSLIWK
Nearest Stachelhaus code(s):: Cys DLFNLSLIWK (74% 8Å match)
Stachelhaus code match:: 100% (strong)

gnlProkkaBNBIDJCA_5 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 23,775 - 46,456 nt. (total: 22,682 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

KnownClusterBlast

Lanthipeptides

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Similar known gene clusters from MIBiG 3.1

No matches found.

Lanthipeptide predictions

Lanthipeptide(s) for ctg5_33

ctg5_34

Leader:

MTEEFIGCIEEELKEIELFYEENGVEVEAYTLHNG

Core:

SFFSICC

Core with dehydrations:

DhaFFDhaICysCys

antiSMASH-DB 4.0 matches for ctg5_34

100.0% NZ_JADPAT010000014.1and 2 others:

NZ_JAQDKC010000001.1 Lanthipeptides: PGQ53_RS00010_lanthipeptideNZ_QUIY01000001.1 Lanthipeptides: allorf_008439_008567_lanthipeptide

Lanthipeptides: allorf_07424_07552_lanthipeptide

1

SFFSICC

7

SFFSICC

1

SFFSICC

7

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg5_34 - Class II: Cleavage pHMM score: -6.60; RODEO score: 0; Monoisotopic mass: 769.3 Da; Molecular weight: 769.9 Da; Number of bridges: 2

gnlProkkaBNBIDJCA_17 - Region 1 - RRE-containing

Download region GenBank file

Download region SVG

Location: 16,861 - 38,408 nt. (total: 21,548 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

KnownClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Similar known gene clusters from MIBiG 3.1

No matches found.

gnlProkkaBNBIDJCA_22 - Region 1 - ranthipeptide

Download region GenBank file

Download region SVG

Location: 32,190 - 51,266 nt. (total: 19,077 nt) Show pHMM detection rules used

Region on contig edge.

ranthipeptide: (TIGR03973 or SCIFF or (cds(PF04055 and (TIGR04085 or SPASM)) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]) and not (TIGR01716 or subtilosin or TIGR02111 or TIGR03966 or TIGR04103 or (YcaO or TIGR03604))))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

KnownClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Similar known gene clusters from MIBiG 3.1

No matches found.

gnlProkkaBNBIDJCA_29 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 36,206 nt. (total: 36,206 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

NRPS/PKS domains

KnownClusterBlast

NRPS/PKS modules

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters from MIBiG 3.1

Module view

Legend

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 36206:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg29_10

AMP-binding (22..421): X

nrpys: Leu, Trp

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVLTDGGISK
Nearest Stachelhaus code(s):: Leu or Trp DVLTDGGISK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1035..1423): X

nrpys: Leu, Trp

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAMFSGAIFK
Nearest Stachelhaus code(s):: Leu or Trp DAMFSGAIFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2029..2420): X

nrpys: Leu, Trp

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAITTGGVSK
Nearest Stachelhaus code(s):: Leu or Trp DAITTGGVSK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

gnlProkkaBNBIDJCA_31 - Region 1 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 20,981 - 39,673 nt. (total: 18,693 nt) Show pHMM detection rules used

Region on contig edge.

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

KnownClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Similar known gene clusters from MIBiG 3.1

No matches found.

gnlProkkaBNBIDJCA_47 - Region 1 - ranthipeptide

Download region GenBank file

Download region SVG

Location: 9,701 - 28,182 nt. (total: 18,482 nt) Show pHMM detection rules used

Region on contig edge.

ranthipeptide: (TIGR03973 or SCIFF or (cds(PF04055 and (TIGR04085 or SPASM)) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]) and not (TIGR01716 or subtilosin or TIGR02111 or TIGR03966 or TIGR04103 or (YcaO or TIGR03604))))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

KnownClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Similar known gene clusters from MIBiG 3.1

No matches found.